Linda P.

asked • 05/03/21

how many fragments?

If i have a string of 34 letters, how many unique fragments of five letters can I obtain? The letters are contiguous.


More specifically, I need to know how many peptides (of five amino acid residues each) I can obtain from a larger peptide that 34 amino acid residues in length. For example the larger peptide is:


VPTELSAISMLYLDENEKVVLKNYQDMVVEGCGC


So, I can obtain a fragment of VPTEL, PTELS, etc...how many of these five residue fragments are possible?


Please also let me know what formula you used to get the answer.

1 Expert Answer

By:

Geoff G. answered • 05/03/21

Tutor
4.9 (46)

Extensive Experience Editing and Proofreading Formal Papers

Still looking for help? Get the right answer, fast.

Ask a question for free

Get a free answer to a quick problem.
Most questions answered within 4 hours.

OR

Find an Online Tutor Now

Choose an expert and meet online. No packages or subscriptions, pay only for the time you need.